PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00058107001
Common NameGSBRNA2T00058107001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 419aa    MW: 45950.7 Da    PI: 6.5138
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00058107001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.7e-33234288155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+ mkv+gLt++hvkSHLQkYR+
  GSBRNA2T00058107001 234 KARMRWTPELHEAFVEAVNSLGGSERATPKGVLKKMKVEGLTIYHVKSHLQKYRT 288
                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.2231291IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-30233290IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-24234288IPR006447Myb domain, plants
SuperFamilySSF466891.79E-16234288IPR009057Homeodomain-like
PfamPF002491.2E-9236287IPR001005SANT/Myb domain
PfamPF143793.9E-24321365IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MEARPVQRSG SRELSNLTRT SSIPSTPNPS SSAAAAEVAF MRSENNNNNN TQFMSKPLGG  60
QNYHLLASSN GGAVGHICSS SSSGFSTNLH YSSMEKHYAS SSSNAAAAAA LRDDSSWCSD  120
SLHGGFLDFP ENHHQACQIE DGGGIGAAFD DIQKRNDWHE WADHLITDED PLLSTNWNDL  180
LLETSSQSDS KDQKTLQVQP QPQIVQQQQP SPSVSVELRP VSTTSSNSNN GNGKARMRWT  240
PELHEAFVEA VNSLGGSERA TPKGVLKKMK VEGLTIYHVK SHLQKYRTAR YRPEPSETGS  300
SEKKLTPLEH ITSLDLKGGM CITEALRLQM EVQKQLHEQL EIQRNLQLRI EEQGKYLQMM  360
FEKQNSGLGK GTASTSDSPS KSEQEDKKVT DSKELTPEGT GKCKEPESPQ PKRPKTDN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.200411e-154leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00058107001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN8061560.0JN806156.1 Brassica napus PHR1 (PHR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302600.10.0protein PHR1-LIKE 1
SwissprotQ8GUN59e-73PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078HBQ60.0A0A078HBQ6_BRANA; BnaA01g08300D protein
STRINGBra010355.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.10.0phosphate starvation response 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]